General Information

  • ID:  hor005814
  • Uniprot ID:  P83055
  • Protein name:  Kininogen-2
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DERNNRDYTIRTRLHGHHKPSRNNRYAIKTSIHGHHIPRNVPESEEKTEQFLRDLPKINRKGPRPPGFSPFRGKFHSQSLRQIPGLGPLRG
  • Length:  91
  • Propeptide:  MRLWFCLSFFIVLCLEHFPGTLADERNNRDYTIRTRLHGHHKPSRNNRYAIKTSIHGHHIPRNVPESEEKTEQFLRDLPKINRKGPRPPGFSPFRGKFHSQSLRQIPGLGPLRG
  • Signal peptide:  MRLWFCLSFFIVLCLEHFPGTLA
  • Modification:  T90 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent vasodilator. Binds B1 (BDKRB1) and B2 (BDKRB2) bradykinin receptors.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83055-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005814_AF2.pdbhor005814_ESM.pdb

Physical Information

Mass: 1224042 Formula: C466H741N159O129
Absent amino acids: CMW Common amino acids: R
pI: 11.88 Basic residues: 26
Polar residues: 26 Hydrophobic residues: 18
Hydrophobicity: -138.68 Boman Index: -32318
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 6077.47 Extinction Coefficient cystines: 2980
Absorbance 280nm: 33.11

Literature

  • PubMed ID:  12948837
  • Title:  Cloning of maximakinin precursor cDNAs from Chinese toad, Bombina maxima, venom.